PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00010594001
Common NameGSBRNA2T00010594001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 220aa    MW: 24014.7 Da    PI: 8.9889
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00010594001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.92.6e-391776463
               zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                         +a+kcprC+s ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+r+nk+sss
  GSBRNA2T00010594001 17 EAQKCPRCESPNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRRNKRSSS 76
                         689*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027017.0E-331873IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.051973IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-222168IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102157IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MEEEMKKKQG KGELEGEAQK CPRCESPNTK FCYYNNYSLS QPRYFCKSCR RYWTKGGTLR  60
NVPVGGGCRR NKRSSSSFSK NINKPVNFHN DPLHNPFTGM PSSFGYDSID LNLAFAALHK  120
HPPSQVTPSF GFGGDVSIYG NSTNTHSGVL GNGLNFGEQN GNFNGGSLWY ENPSKVLLGF  180
PWQITGNSAG GVPETDPGRE SWNGLVSSWS SGLLNTPLV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00010594001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892990.0AC189299.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB028K05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013744165.11e-148PREDICTED: dof zinc finger protein DOF2.1-like
SwissprotQ8LE436e-93DOF21_ARATH; Dof zinc finger protein DOF2.1
TrEMBLA0A078IVC31e-161A0A078IVC3_BRANA; BnaA04g16440D protein
STRINGBra035696.1-P1e-152(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69602743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28510.12e-76Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]